Zosma82g00230.1 (PRGDB2169500)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2169500	Zosma82g00230.1	RLP	putative	TM, LRR	Zostera marina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Zosma217g00180.1	Zostera marina	70.5	112	3e-51
orange1.1g045950m	Citrus sinensis	69.9	93	4e-38
Ciclev10005037m	Citrus clementina	69.9	93	7e-38
Phvul.007G060800.1	Phaseolus vulgaris	63.5	96	1e-37
Manes.03G174200.1.p	Manihot esculenta	56.6	113	2e-37
Thecc1EG020681t1	Theobroma cacao	63.8	94	6e-37
Manes.03G174300.1.p	Manihot esculenta	63.8	94	7e-37
MDP0000242921	Malus domestica	47	149	9e-37
Medtr1g103080.1	Medicago truncatula	58.3	96	1e-36
29844.m003235	Ricinus communis	64	100	2e-36

Showing 1 to 10 of 499 entries

Protein sequence

MMPSTLGRLQYHHNVFLIIFFLSCTFLSLMPVSSCTAQTKSTPPHHCNCTCTCAPQWEPLNMKLRKAYSV
FQSWKNVITCDPQDVTSDWYGANVCDYTGVYCSPAPDDPNVLTVSGIDLNGAGICGTLPEELGLLADLAL
VHLNSNRFTGKIPSLAGGRYELSLYIYGQFQVR