Zosma71g00110.1 (PRGDB2169506)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2169506	Zosma71g00110.1	RLP	putative	LRR, TM	Zostera marina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Zosma163g00120.1	Zostera marina	80.4	153	1e-76
Zosma113g00290.1	Zostera marina	88.2	135	2e-76
Zosma91g00510.1	Zostera marina	88.9	117	1e-61
Zosma17g00460.1	Zostera marina	90.9	99	2e-53
GSMUA_Achr7P10800_001	Musa acuminata	65.7	105	4e-38
Kalax.0344s0006.1.p	Kalanchoe marnieriana	50.7	140	4e-36
Kalax.0059s0069.1.p	Kalanchoe marnieriana	50.7	140	5e-36
Zosma12g00710.1	Zostera marina	66	100	1e-35
Ciclev10008452m	Citrus clementina	59	105	1e-35
orange1.1g039087m	Citrus sinensis	59	105	1e-35

Showing 1 to 10 of 499 entries

Protein sequence

MPLSITGKKCTHRPPTSRSYFSRLTDDELPKQSTLPITFSNNKLTGCIPEDIGFTTNMEVLDFNSFTGHL
PTSISCLSDIQVFNIAHNQISGVFPDVVCSMRSLMNLTISFNFFSGFSHYCTKSFQGFDFSENFSPILPI
SAWVSVPTP