Zosma115g00280.1 (PRGDB2169507)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2169507	Zosma115g00280.1	L	putative	LRR	Zostera marina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Zosma92g00750.1	Zostera marina	93.8	128	7e-75
Zosma111g00350.1	Zostera marina	82.6	132	7e-67
Phvul.002G007800.1	Phaseolus vulgaris	60.8	125	4e-45
Glyma.01G197600.1.p	Glycine max	59.2	125	3e-43
Eucgr.H02351.1.p	Eucalyptus grandis	57.1	126	5e-42
Eucgr.H02351.2.p	Eucalyptus grandis	57.1	126	6e-42
orange1.1g039922m	Citrus sinensis	59.4	123	1e-41
Ciclev10026946m	Citrus clementina	57.7	123	3e-40
Manes.13G106200.1.p	Manihot esculenta	55.6	124	1e-39
Eucgr.H02353.1.p	Eucalyptus grandis	54	126	4e-39

Showing 1 to 10 of 499 entries

Protein sequence

MLTEFAGLHLVSLGLNDNFFEGKIPGSISSDPNLIELKLFNNSFSGKLPQDLGRNSNLELFDVSTNRFVG
ELPVDICHRGALTSLIAFNNKFNESLPAKYGECNTLSYIRVQNNSLPGEVPELFWKLSGEVIISSKALFP
F