Zosma76g00170.1 (PRGDB2169508)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2169508	Zosma76g00170.1	RLP	putative	TM, LRR	Zostera marina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Migut.H02115.1.p	Erythranthe guttata	55.6	133	3e-41
Cucsa.185230.1	Cucumis sativus	52.6	135	5e-40
mrna05715.1-v1.0-hybrid	Fragaria vesca	51.8	139	5e-39
Potri.004G135500.1	Populus trichocarpa	55.6	117	4e-38
Potri.004G135500.2	Populus trichocarpa	55.6	117	4e-38
Glyma.02G288600.1.p	Glycine max	49.3	150	2e-37
Aqcoe4G025800.1.p	Aquilegia caerulea	50.4	137	2e-37
Prupe.3G168800.5.p	Prunus persica	48.9	137	3e-37
Prupe.3G168800.6.p	Prunus persica	48.9	137	3e-37
Prupe.3G168800.7.p	Prunus persica	48.9	137	3e-37

Showing 1 to 10 of 499 entries

Protein sequence

MAVNDHHNYLFLFSMFIFCFYSCRCEKVTASPKLVKKEVDALKEIAKGLGKKNWNFSYDPCSGEGNWILP
NATKGFESFVTCDCSFATSTFCRVVSFRVLKAQNLTGILPPQIARLRFLKHLDLTRNLLKGAVPSQWTTL
PLLEL