DCAR_004831 (PRGDB2172818)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2172818	DCAR_004831	L	putative	LRR	Daucus carota

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Mapoly0100s0059.2.p	Marchantia polymorpha	66.1	59	9e-22
Mapoly0100s0059.3.p	Marchantia polymorpha	66.1	59	9e-22
Mapoly0100s0059.1.p	Marchantia polymorpha	66.1	59	9e-22
EFJ14473	Selaginella moellendorffii	62.7	59	4e-20
EFJ26072	Selaginella moellendorffii	62.7	59	4e-20
Pp3c1_24850V3.3.p	Physcomitrella patens	64.4	59	1e-19
Pp3c1_24850V3.1.p	Physcomitrella patens	64.4	59	1e-19
Pp3c1_24850V3.2.p	Physcomitrella patens	64.4	59	1e-19
OBART01G29460.1	Oryza barthii	67.9	56	3e-19
LOC_Os01g52640.3	Oryza sativa	67.9	56	3e-19

Showing 1 to 10 of 43 entries

Protein sequence

MSIRSKLSCLSWNKYTKSHLASSDYEGIVTVWDVNTRQSVMEYEEHEKRAWSVDFSKTERGVKCLCLGVM
TAR