DCAR_029355 (PRGDB2172828)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2172828	DCAR_029355	L	putative	LRR	Daucus carota

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
DCAR_029356	Daucus carota	81.7	109	5e-52
DCAR_005198	Daucus carota	48.5	103	1e-21
DCAR_005192	Daucus carota	45	109	4e-20
DCAR_005216	Daucus carota	47.4	97	2e-19
DCAR_005190	Daucus carota	45.4	97	4e-15
MDP0000399716	Malus domestica	36.4	99	2e-11
Gorai.003G148900.1	Gossypium raimondii	36.5	96	2e-10
Pp3c21_14179V3.1.p	Physcomitrella patens	36.2	105	4e-10
VIT_13s0147g00120.t01	Vitis vinifera	33.3	99	5e-10
Pp3c21_14231V3.1.p	Physcomitrella patens	35.2	105	6e-10

Showing 1 to 10 of 296 entries

Protein sequence

MTIYHKDHQKHKTVKTLPGTVCNLRELEVLSVGHSRGLEALLVELGNIESLKELNVHDVIVSKLPDSIGC
LINLVKLRFTDNKNLETLPHTMRTMRSLKTPDIDDCSNLEPSRLV