DCAR_022763 (PRGDB2173045)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2173045	DCAR_022763	KIN	putative	TM, Kinase	Daucus carota

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
DCAR_023505	Daucus carota	91.2	114	4e-65
VIT_01s0010g01660.t01	Vitis vinifera	86.8	114	2e-61
orange1.1g048055m	Citrus sinensis	80.7	114	7e-60
PGSC0003DMT400068806	Solanum tuberosum	79	114	8e-60
Cucsa.372070.2	Cucumis sativus	82.5	114	7e-59
Cucsa.372070.1	Cucumis sativus	82.5	114	7e-59
DCAR_026861	Daucus carota	83.3	114	7e-59
Potri.010G097200.1	Populus trichocarpa	80.7	114	3e-58
Gorai.008G171200.1	Gossypium raimondii	80.7	114	6e-58
Prupe.1G343600.1.p	Prunus persica	82.5	114	6e-58

Showing 1 to 10 of 499 entries

Protein sequence

MVILFVLAAHVELLTGKTPFQDLVQEHGADIPRWVRSVREEETESGDDPGSSNEGSGEKLAALLNIAMAC
VALTPNNRLKMREVLRMIKETRAEAQVSSNSSDHSPGRWSDIVQSLPREDNLSI