DCAR_024873 (PRGDB2173055)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2173055	DCAR_024873	KIN	putative	TM, Kinase	Daucus carota

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
DCAR_024875	Daucus carota	97.6	123	2e-78
DCAR_024876	Daucus carota	82.9	123	4e-64
DCAR_024883	Daucus carota	71.3	122	2e-46
DCAR_016927	Daucus carota	66.7	108	4e-43
DCAR_002040	Daucus carota	69.5	105	5e-40
DCAR_024884	Daucus carota	63.8	116	3e-36
Manes.16G015100.1.p	Manihot esculenta	54	124	2e-33
Glyma.08G061000.1.p	Glycine max	52.9	123	2e-33
Phvul.002G219900.1	Phaseolus vulgaris	52	123	4e-32
DCAR_028177	Daucus carota	54.5	123	8e-32

Showing 1 to 10 of 499 entries

Protein sequence

MGRKNTSYYAENCVNLIGHVWGLWRESRAMEIVDREWLGESHEHDSQIFRCIRIGLLCVQESAAARPSMS
EVVFMLCNEISLPPPDQAAFIFRASDKVLTNTSSSSVGVISVNNVTISTVEGR