genemark_scaffold23590_abinit_gene_0_22_mRNA_1 (PRGDB2174886)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2174886	genemark_scaffold23590_abinit_gene_0_22_mRNA_1	L	putative	LRR	Solanum commersonii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
snap_masked_scaffold42613_abinit_gene_0_32_mRNA_1	Solanum commersonii	99.1	115	4e-73
maker_scaffold8156_augustus_gene_0_51_mRNA_1	Solanum commersonii	61.7	115	1e-32
PGSC0003DMT400008870	Solanum tuberosum	61.7	115	2e-31
Solyc12g097010.1.1	Solanum lycopersicum	71.3	87	8e-31
Solyc07g052770.2.1	Solanum lycopersicum	69.2	78	4e-25
genemark_scaffold12773_abinit_gene_0_10_mRNA_1	Solanum commersonii	43.5	115	1e-23
Ciclev10004174m	Citrus clementina	52	100	3e-23
Solyc11g062180.1.1	Solanum lycopersicum	86.3	51	3e-23
maker_scaffold10871_snap_gene_0_15_mRNA_1	Solanum commersonii	57	107	5e-23
maker_scaffold7602_snap_gene_0_12_mRNA_1	Solanum commersonii	69.6	69	3e-22

Showing 1 to 10 of 499 entries

Protein sequence

MHYLTQLTLNSTGIREVPSSIGHLRGLEYLYLSGCEELLSLPDSLCNLMKLQCLYLDRCKKLEKLPENIG
DLQDLHILDASETAISQLPPSITKLGKLWKLRFSHEQQFQHSSSLS