maker_scaffold26705_augustus_gene_0_21_mRNA_1 (PRGDB2175563)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2175563	maker_scaffold26705_augustus_gene_0_21_mRNA_1	KIN	putative	Kinase	Solanum commersonii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400039232	Solanum tuberosum	95	140	1e-93
PGSC0003DMT400039237	Solanum tuberosum	95	140	5e-92
Solyc03g111540.1.1	Solanum lycopersicum	95	140	5e-91
Thecc1EG030121t1	Theobroma cacao	73	141	1e-72
orange1.1g021771m	Citrus sinensis	74.5	141	2e-72
orange1.1g026939m	Citrus sinensis	73.8	141	3e-72
Thecc1EG030126t1	Theobroma cacao	75.9	141	8e-72
Thecc1EG030126t2	Theobroma cacao	75.9	141	1e-71
Eucgr.E02448.2.p	Eucalyptus grandis	75.3	142	2e-71
Ciclev10001299m	Citrus clementina	74.5	141	2e-71

Showing 1 to 10 of 499 entries

Protein sequence

MDLKASNILLDKDMNPKISDFGMAKMFSGNQQEVNTNRVVGTYGYMAPEYAMEGPFSTKSDVFSFGVLLL
EIVSGRKNNSYVSEYGQSLLNFAWKLWREGHGLELMDPCLSQSCVTTEITKCIHLGLLCVQQDPADRPTM
SC