ConsensusfromContig38303-snap_masked-ConsensusfromContig38303-abinit-gene-0.1-mRNA-1:cds:7967/107-194:0:- (PRGDB2176890)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2176890	ConsensusfromContig38303-snap_masked-ConsensusfromContig38303-abinit-gene-0.1-mRNA-1:cds:7967/107-194:0:-	N	putative	NBS, TM	Cyanophora paradoxa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Mapoly0040s0011.1.p	Marchantia polymorpha	44.7	152	3e-30
10007	Ostreococcus lucimarinus	39.2	153	5e-26
EFJ36575	Selaginella moellendorffii	41.4	157	1e-24
Mapoly0133s0051.1.p	Marchantia polymorpha	45.8	153	2e-24
EFJ18471	Selaginella moellendorffii	40.8	157	4e-24
Pp3c21_7530V3.3.p	Physcomitrella patens	41.2	153	3e-22
Pp3c21_7530V3.2.p	Physcomitrella patens	41.2	153	3e-22
Pp3c21_7530V3.1.p	Physcomitrella patens	41.2	153	3e-22
Carubv10016572m	Capsella rubella	39.7	151	7e-22
DCAR_024176	Daucus carota	37.2	153	3e-21

Showing 1 to 10 of 199 entries

Protein sequence

MPSPLGIRLETVGSLVVLSASLFAIAAHDLLGPLVGLSVSSALGLSANLNWAVRQFTELEVQMNAVERIL
QYRSIEPEAPLDGGPPRGRVEFKDVTLRYRPAAPPVLQGVTAAIRPGEKVGIVGRTGAGKSTLTIALFRV
VELAAGR