ConsensusfromContig15113-snap_masked-ConsensusfromContig15113-abinit-gene-0.0-mRNA-1:cds:5030/140-143:0:+ (PRGDB2177235)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2177235	ConsensusfromContig15113-snap_masked-ConsensusfromContig15113-abinit-gene-0.0-mRNA-1:cds:5030/140-143:0:+	N	putative	NBS, TM	Cyanophora paradoxa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c2_36840V3.3.p	Physcomitrella patens	45.2	166	2e-40
Glyma.05G019400.2.p	Glycine max	47.6	164	2e-40
Glyma.05G019400.1.p	Glycine max	47.6	164	2e-40
MLOC_54097.3	Hordeum vulgare	44.5	164	3e-40
Glyma.17G080400.1.p	Glycine max	47	164	4e-40
Pp3c2_36840V3.6.p	Physcomitrella patens	45.2	166	4e-40
Pp3c2_36840V3.2.p	Physcomitrella patens	45.2	166	4e-40
Pp3c2_36840V3.1.p	Physcomitrella patens	45.2	166	4e-40
OPUNC01G40160.2	Oryza punctata	46	163	5e-40
Bradi2g58380.3.p	Brachypodium distachyon	44.5	164	5e-40

Showing 1 to 10 of 499 entries

Protein sequence

MGAITVGDLTAFSMYAVYAGLGITGASSVYSELMRAVGASARVFEILERVPAVPCSGGRRLERLEGHVEL
RGVVFRYPTRPEAEVLSGLDLAIHPGRMVAVVGGSGSGKSTIAALIARLYEPDAGAVLFDGVDARTLDPR
WLRESIGIVPQELTLFATSIRENI