Brast01G225800.1.p (PRGDB217915)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB217915	Brast01G225800.1.p	RLP	putative	LRR, TM	Brachypodium stacei

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bradi2g42820.3.p	Brachypodium distachyon	81.6	114	1e-49
TRIUR3_18451-P1	Triticum urartu	66.1	109	1e-36
Traes_4BS_E06645A2D.2	Triticum aestivum	64.9	114	3e-35
MLOC_66818.1	Hordeum vulgare	58.2	122	5e-34
MLOC_18450.1	Hordeum vulgare	60.7	117	6e-33
MLOC_18450.2	Hordeum vulgare	60.7	117	6e-33
Traes_6BL_FEAB65531.1	Triticum aestivum	58.8	114	1e-32
Traes_6BL_FEAB65531.2	Triticum aestivum	58.8	114	2e-32
Traes_6BL_AE53824F7.1	Triticum aestivum	64.9	94	2e-32
MLOC_75611.1	Hordeum vulgare	58	112	2e-32

Showing 1 to 10 of 499 entries

Protein sequence

MAVELRFLVRAVAAVALFLLISQLAPSASGAQARGVSGGAPGTCITAERDALLSFKASLLDPAGRLSSWQ
GEDCCLWSGVRCSNRSGHVVKLNLRNTFDGFREQSALSLSTGIALEKWAGHLGRAHSSVSPVEAALQEDV
ADGTGELHQIHGAQAGRTASHSLVLTPRFGTGGTELPARAH