Bo9g064370.1 (PRGDB219885)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219885	Bo9g064370.1	T	putative	TIR	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.7393s0010.1.p	Conradina grandiflora	84.2	57	7e-26
Cagra.0569s0023.1.p	Conradina grandiflora	80.7	57	4e-24
883912	Arabidopsis lyrata	82.8	58	6e-24
AT5G22690.1	Arabidopsis thaliana	73.8	61	1e-23
Bostr.28243s0010.1.p	Babiana stricta	80.7	57	2e-23
883910	Arabidopsis lyrata	81	58	2e-23
Cagra.0569s0025.1.p	Conradina grandiflora	79.3	58	3e-23
Thhalv10001229m	Eutrema salsugineum	79.3	58	5e-23
Bostr.5055s0001.1.p	Babiana stricta	75.9	58	1e-22
Araha.8200s0005.1.p	Arabidopsis halleri	75.9	58	2e-22

Showing 1 to 10 of 499 entries

Protein sequence

MDYRNWLYDVFPSFSWEDVRINFLSHFLKELDRKLINAFKDNEIERSHSIAPALVTAIRTSLCSRQSMPL
PVGVWTSWLRS