Bo17086s010.1 (PRGDB219891)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219891	Bo17086s010.1	T	putative	TIR	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
359364	Arabidopsis lyrata	62.2	119	7e-47
Cagra.0493s0009.1.p	Conradina grandiflora	60.8	120	7e-46
Bostr.8819s0050.1.p	Babiana stricta	59.2	120	1e-45
Thhalv10000751m	Eutrema salsugineum	65	120	1e-45
Araha.4174s0003.1.p	Arabidopsis halleri	58.2	122	4e-44
Araha.4174s0001.1.p	Arabidopsis halleri	61.7	120	5e-44
333306	Arabidopsis lyrata	59.5	121	1e-43
Araha.1947s0007.1.p	Arabidopsis halleri	64	114	4e-41
Cagra.3925s0001.1.p	Conradina grandiflora	59.8	117	2e-40
884087	Arabidopsis lyrata	58.1	124	4e-40

Showing 1 to 10 of 499 entries

Protein sequence

NDKAQVFINFRGADLRSHFAPYLHDVLHKNGINAFIDDKLEVGDDLTDLFEKIEESTVAVAIISSRYTES
DWCLNELVKIKECVDRRTLRVIPVFYKLEISIVKKLKGSFGLQLWKLWRKENH