Bo9g061180.1 (PRGDB219897)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219897	Bo9g061180.1	T	putative	TM, TIR	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT5G45200.1	Arabidopsis thaliana	60.1	163	3e-52
Bostr.8819s0016.1.p	Babiana stricta	58.6	162	2e-50
338955	Arabidopsis lyrata	54.7	150	2e-50
Bostr.8819s0012.1.p	Babiana stricta	56.6	159	6e-48
884099	Arabidopsis lyrata	56.5	161	5e-46
Cagra.1410s0003.1.p	Conradina grandiflora	54.7	161	1e-45
Araha.4174s0005.1.p	Arabidopsis halleri	55	160	9e-45
916959	Arabidopsis lyrata	48.1	158	2e-44
Thhalv10001215m	Eutrema salsugineum	53.4	161	4e-44
Araha.1947s0003.1.p	Arabidopsis halleri	48.1	158	6e-44

Showing 1 to 10 of 499 entries

Protein sequence

MATSTSSNPVHQPPQHKVFLNFRGADLRLNFISHLVGALQMEGINYFIDEDEMRGEKLEKLFKTIEESSI
AIVVISSKYTESEWCLNELAKIKECVEEERMRVFPVFYKVTVASVKDKKGNFRDYLTKLSSDRKETWENA
LDFVTSRLGQTVDEKSDSFPT