Bo9g064340.1 (PRGDB219912)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219912	Bo9g064340.1	N	putative	NBS	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.28366s0002.1.p	Arabidopsis halleri	76.2	143	5e-68
Bostr.3148s0208.1.p	Babiana stricta	74.1	143	8e-68
Bostr.8819s0175.1.p	Babiana stricta	70.6	143	3e-63
Thhalv10003136m	Eutrema salsugineum	68.3	142	6e-60
494346	Arabidopsis lyrata	67.9	140	2e-57
AT5G40060.1	Arabidopsis thaliana	66.2	139	2e-57
Bostr.28243s0042.1.p	Babiana stricta	62.8	148	5e-56
Araha.5427s0001.2.p	Arabidopsis halleri	66.4	140	7e-55
AT5G46270.1	Arabidopsis thaliana	62.8	148	1e-54
Bostr.4485s0017.1.p	Babiana stricta	62.8	148	1e-54

Showing 1 to 10 of 499 entries

Protein sequence

MLCRSAFRQNSPREGFEKLAVEVTRHAGSLPLGLKVLGSALRGRDKAYWMDILPTLQNGVGEKIEKTLRI
SYDGLDREEDKVIYRHIACLFNGEKIPYIKLLLEDRNLGVNVGIENLVDKSLIHIRSDNVEMHSLLQEIA
LKLSLTGAFASTYFHPSCSRVAGRSGSGCFATFSFNNE