Bo00947s050.1 (PRGDB219916)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219916	Bo00947s050.1	N	putative	NBS	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bo9g010670.1	Brassica oleracea	85.1	74	3e-36
Thhalv10025864m	Eutrema salsugineum	76.9	65	3e-29
Cagra.9536s0019.1.p	Conradina grandiflora	69.9	73	5e-28
Cagra.9536s0019.2.p	Conradina grandiflora	69.9	73	5e-28
AT4G19060.1	Arabidopsis thaliana	71.2	73	5e-28
492949	Arabidopsis lyrata	70.4	71	4e-27
Bostr.30275s0389.1.p	Babiana stricta	62.2	74	8e-22
Thhalv10003489m	Eutrema salsugineum	59.2	76	1e-18
AT5G45440.1	Arabidopsis thaliana	52	73	1e-17
Araha.1483s0007.1.p	Arabidopsis halleri	59.7	67	4e-17

Showing 1 to 10 of 38 entries

Protein sequence

MTQKKLIQNKSLFLKNFLLKHKGSEEFRTLAIVGKFGVGKTTLCQDGFNDKDVKEAYLPRVWVSIYSEES
KEDPKGSCVEEDLGITWS