Bo9g025770.1 (PRGDB220207)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220207	Bo9g025770.1	N	putative	NBS	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thhalv10008317m	Eutrema salsugineum	92.4	144	2e-94
Bostr.22592s0002.1.p	Babiana stricta	92.4	144	7e-94
Cagra.0897s0075.1.p	Conradina grandiflora	92.4	144	8e-94
AT1G03030.1	Arabidopsis thaliana	92.4	144	1e-83
Araha.39200s0007.1.p	Arabidopsis halleri	91.7	144	5e-83
470280	Arabidopsis lyrata	91.7	144	9e-83
VIT_07s0141g00310.t01	Vitis vinifera	79.9	144	9e-82
Manes.05G084500.1.p	Manihot esculenta	80.6	144	2e-81
Potri.005G218700.2	Populus trichocarpa	79.9	144	9e-81
Potri.005G218700.1	Populus trichocarpa	79.9	144	9e-81

Showing 1 to 10 of 124 entries

Protein sequence

MDEIYDKLAERLVPTSAAMFSPNVKRLVGLAGPPGAGKSTLAYEVVSRINSLWPQKAASFDAEVMPPDVA
TVLPMDGFHLYRSQLDAMEDPKEAHARRGAPWTFNPALLLNCLKKLRNEGSVYVPSFDHGVGDPVEDDIF
VSLQ