Bo07761s010.1 (PRGDB220251)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220251	Bo07761s010.1	TN	putative	NBS, TM, TIR	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.8819s0025.1.p	Babiana stricta	45.1	164	2e-34
Araha.1947s0005.1.p	Arabidopsis halleri	39.3	163	3e-28
AT5G44870.1	Arabidopsis thaliana	33.2	211	8e-26
900967	Arabidopsis lyrata	37	162	2e-21
Thhalv10000019m	Eutrema salsugineum	34.8	158	1e-18
330904	Arabidopsis lyrata	46.6	88	4e-18
AT4G36150.1	Arabidopsis thaliana	34.5	165	1e-17
856927	Arabidopsis lyrata	33.7	163	2e-17
Bostr.8819s0039.1.p	Babiana stricta	36.2	160	6e-17
Bostr.8819s0039.2.p	Babiana stricta	36.2	160	7e-17

Showing 1 to 10 of 499 entries

Protein sequence

MKQAEQGNLRVIPIFFNVTPKDVGSPYGSFGCKVYVESQHNPSSLPIWTKALKSAAGNIGLLLKNYRNEM
LLIQEILASVKKVLALEPNTHNVPFRQTSPSKNPSEDWSTPLCQKRVPTRIKQLQEMIDFNCDQTQIVGI
VGMPGIGKTSLAEEYFERSND