Bo15690s010.1 (PRGDB220255)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220255	Bo15690s010.1	N	putative	NBS	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bo10871s010.1	Brassica oleracea	70.7	133	8e-63
Araha.68678s0001.1.p	Arabidopsis halleri	62.8	137	3e-53
Bo9g046560.1	Brassica oleracea	65.7	137	7e-52
Cagra.16459s0003.1.p	Conradina grandiflora	64.2	137	4e-50
Cagra.16459s0003.2.p	Conradina grandiflora	64.2	137	4e-50
Cagra.16459s0002.1.p	Conradina grandiflora	66.2	133	4e-50
Bostr.10040s0278.1.p	Babiana stricta	62	137	4e-49
Araha.9388s0001.1.p	Arabidopsis halleri	59	139	5e-46
Thhalv10023259m	Eutrema salsugineum	63.1	122	7e-46
Cagra.4331s0001.1.p	Conradina grandiflora	60.6	137	9e-46

Showing 1 to 10 of 499 entries

Protein sequence

MPPQDEQRQTFYIVDEEQPIVGMEKNIELVVGYLLEEDSRQVFAITGMGGIGKTTLARKVFNHEKIKKHF
QEGLAWVCVSQHFEKKTIWQTILQQLRPECDVSKMMEGKLLEKIVRVLETQKALFVIDDIWREGDWDLIK