Carubv10018648m (PRGDB220274)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220274	Carubv10018648m	CT	putative	CC, TIR	Capsella rubella

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.10022s0001.1.p	Conradina grandiflora	94.4	198	3e-132
864783	Arabidopsis lyrata	77.7	179	8e-97
Bostr.28243s0030.1.p	Babiana stricta	75.8	190	1e-96
Araha.13567s0001.1.p	Arabidopsis halleri	77.1	179	4e-96
Carubv10019041m	Capsella rubella	77.1	179	5e-96
AT2G03300.1	Arabidopsis thaliana	76.5	179	4e-95
Carubv10019542m	Capsella rubella	75.6	180	1e-94
Bostr.28243s0034.1.p	Babiana stricta	74.5	188	1e-94
Thhalv10005549m	Eutrema salsugineum	78.8	170	2e-92
Araha.49972s0001.1.p	Arabidopsis halleri	73.7	179	3e-91

Showing 1 to 10 of 499 entries

Protein sequence

MSITVSRAENHQVFFNYRGEQLGYYFVSHLSDAFERHQIKFFIDKDEQRGKDLKHLFVRIEESTVALAIF
STGYPESRWCMDELVKMKKLADQRKLLVIPIFYKVAARDVREQTGKFGDNFWNLAKASSGEQIKKWKEAL
ECISDKMGLSLGDKSSEADFVKEIVKEVQRVMATIEFEEEENHLGNKKAK