evm.model.supercontig_114.60 (PRGDB220649)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220649	evm.model.supercontig_114.60	KIN	putative	Kinase	Carica papaya

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Gorai.002G251800.1	Gossypium raimondii	81	79	7e-39
Gorai.002G251800.2	Gossypium raimondii	81	79	7e-39
Thecc1EG022063t1	Theobroma cacao	76.4	89	3e-38
Prupe.6G244400.2.p	Prunus persica	83.3	78	8e-37
Prupe.6G244400.1.p	Prunus persica	83.3	78	8e-37
MDP0000119237	Malus domestica	83.3	78	2e-36
MDP0000266660	Malus domestica	83.3	78	6e-36
MDP0000273596	Malus domestica	82	78	1e-35
mrna18153.1-v1.0-hybrid	Fragaria vesca	80.8	78	2e-35
PGSC0003DMT400071735	Solanum tuberosum	78.2	78	6e-35

Showing 1 to 10 of 499 entries

Protein sequence

MADPMLQGQYPSRGLYQALAVAAMCVQEHPNMRPVIADVVTALSYLASQKYEPETQPVQGTYLPATPPRT
KRDRDRKMAPNFNWNAPR