evm.model.supercontig_165.50 (PRGDB220654)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220654	evm.model.supercontig_165.50	KIN	putative	TM, Kinase	Carica papaya

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
evm.model.supercontig_165.48	Carica papaya	99.9	120	1e-76
Ciclev10024479m	Citrus clementina	60.7	117	1e-35
Prupe.8G217900.1.p	Prunus persica	52.6	135	2e-35
Ciclev10024331m	Citrus clementina	60.7	117	3e-35
Potri.014G195200.1	Populus trichocarpa	55.1	118	8e-33
GRMZM2G001812_P01	Zea mays	45.4	152	6e-31
GSMUA_Achr4P18230_001	Musa acuminata	52.1	119	8e-31
MDP0000321712	Malus domestica	42.9	147	1e-30
AHYPO_009769-RA	Amaranthus hypochondriacus	58	100	5e-30
evm_27.model.AmTr_v1.0_scaffold00067.215	Amborella trichopoda	50.4	113	7e-29

Showing 1 to 10 of 499 entries

Protein sequence

MLPRISTAECISLNSNVSTNSFLMFFPVAELASTMKLTEKCDVYSFGVIALEVLMGTHPNELLSSLQSTG
GYDQLFSDILDKGLTPPSDQVAEDLVLAASLALICVRENPTSRPTMHQVSREFSVRTYHRQLAHFNRLTL
QDVIDIVPN