orange1.1g046164m (PRGDB221676)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB221676	orange1.1g046164m	T	putative	TIR	Citrus sinensis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Ciclev10018304m	Citrus clementina	97.5	202	8e-148
Thecc1EG029929t1	Theobroma cacao	72.5	189	1e-96
Potri.004G038200.1	Populus trichocarpa	73	185	8e-96
Manes.17G042000.1.p	Manihot esculenta	75.4	195	4e-95
Potri.011G046800.1	Populus trichocarpa	73.2	190	2e-94
Gorai.010G151500.1	Gossypium raimondii	68.7	198	2e-92
Manes.16G024000.1.p	Manihot esculenta	74.6	173	5e-92
Prupe.4G041100.1.p	Prunus persica	71	190	6e-92
MDP0000178596	Malus domestica	78.1	160	2e-88
Glyma.07G193000.1.p	Glycine max	70.2	188	2e-88

Showing 1 to 10 of 499 entries

Protein sequence

MQRYSSTKSLCRKIIHHRPHHQIQLPITRRPCDVFINHRGTDTKRTIAGLLHDHLSRLRLNPFLDSKNMK
PGDRLFDKIDTAIKHCKLGVAVFSPRYCESYFCLHELALIMESRKKVIPIFYDVKPSQLQVPDNGTCSRK
ELQRFSRALEEAKYTVGLTFDSINGDWSEFLTTATDAVINNLIEVEEESTANREPMGFLQNY