Cagra.15322s0005.1.p (PRGDB225285)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225285	Cagra.15322s0005.1.p	T	putative	TIR	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
313276	Arabidopsis lyrata	85.6	160	1e-86
Bostr.12659s0277.1.p	Babiana stricta	82.6	161	7e-84
AT1G27170.2	Arabidopsis thaliana	82.3	158	7e-81
AT1G27180.1	Arabidopsis thaliana	66.9	166	1e-62
880792	Arabidopsis lyrata	71.3	136	2e-57
Bo13372s010.1	Brassica oleracea	60.3	136	9e-49
Cagra.15322s0004.1.p	Conradina grandiflora	60.4	149	4e-47
Thhalv10023218m	Eutrema salsugineum	57.7	149	1e-45
Potri.012G053200.1	Populus trichocarpa	54.4	147	4e-45
Bostr.12659s0277.2.p	Babiana stricta	56.5	154	5e-45

Showing 1 to 10 of 499 entries

Protein sequence

MKTSDVSDLRSRLKWDVFLSFQRDTRHKFTDRLYEVLVKEQVRVWNDDVERENDDELGASLLEEAMEDSV
ALVVVLSPNYAKSHRCLEELAKICHLKTSLGRLVLPIFYEVEPWIFRKQNGPFEMDFEEHSKRFSEEKMQ
RWRKAMNLVGNISGFVFRYGLQ