Cagra.6207s0001.1.p (PRGDB225293)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225293	Cagra.6207s0001.1.p	T	putative	TIR	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Carubv10019041m	Capsella rubella	97.8	137	1e-95
864783	Arabidopsis lyrata	94.9	137	6e-93
Araha.13567s0001.1.p	Arabidopsis halleri	94.9	137	3e-92
AT2G03300.1	Arabidopsis thaliana	94.9	137	2e-91
Carubv10019542m	Capsella rubella	91.4	140	3e-89
Carubv10019057m	Capsella rubella	90.4	136	2e-86
Bostr.13709s0001.1.p	Babiana stricta	87.9	140	2e-85
AT2G03030.1	Arabidopsis thaliana	93.4	137	5e-83
Araha.49972s0001.1.p	Arabidopsis halleri	82.1	140	8e-81
Bostr.0556s0153.1.p	Babiana stricta	89.7	126	2e-77

Showing 1 to 10 of 499 entries

Protein sequence

MTLFSSTQVFLNYRGEQLRYSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESRIALAIFSTRY
TESSWCMDELVKMKKLADKRKLHVIPIFYKVKAEDVRKQTGEFGDNFWKLAKVSSGDQIKKWKEALE