Cagra.11588s0001.1.p (PRGDB225309)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225309	Cagra.11588s0001.1.p	T	putative	TM, TIR	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
883903	Arabidopsis lyrata	73.6	144	6e-71
AT5G46490.1	Arabidopsis thaliana	69	145	2e-66
Bostr.8819s0175.1.p	Babiana stricta	70.3	145	7e-66
Bostr.8819s0189.2.p	Babiana stricta	72.4	145	6e-65
Bostr.8819s0189.1.p	Babiana stricta	72.4	145	6e-65
883914	Arabidopsis lyrata	69.2	146	6e-64
Bo9g064250.1	Brassica oleracea	64.6	147	6e-64
Bo9g064380.1	Brassica oleracea	64.8	145	6e-64
Bostr.28243s0020.1.p	Babiana stricta	71	145	1e-63
Bostr.5055s0001.1.p	Babiana stricta	64.8	145	1e-63

Showing 1 to 10 of 499 entries

Protein sequence

MSSRNWQYDVFISFRGEDVRHNFVSHFLKELGRKMITTFEDTEIEKGESLDPVLKKTIKDSRIAVVLFSK
NYASSSWCLNELLEIVQCHKDIDQVVIPIFYGVDPSHVRHQTGDFGTIFKETCKKNTEDLQNQWKLALTK
VANLVGICVMDRFIKNKNL