Dusal.0347s00013.1.p (PRGDB228199)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228199	Dusal.0347s00013.1.p	N	putative	NBS	Dunaliella salina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Vocar.0006s0118.2.p	Volvox carteri	84.4	179	1e-100
Vocar.0006s0118.1.p	Volvox carteri	84.4	179	3e-100
Cre09.g398550.t1.2	Chlamydomonas reinhardtii	84.3	178	1e-98
79795	Micromonas	79.3	179	5e-94
37691	Ostreococcus lucimarinus	76.3	177	3e-91
Mapoly0026s0136.1.p	Marchantia polymorpha	74.9	179	1e-90
36149	Coccomyxa subellipsoidea	75.7	177	8e-88
33829	Micromonas pusilla	76.1	180	7e-87
Migut.J01532.1.p	Erythranthe guttata	62.9	175	4e-73
evm.model.supercontig_0.174	Carica papaya	62.6	174	3e-70

Showing 1 to 10 of 498 entries

Protein sequence

MHPERFQALGLSSATGVLLYGPPGCGKTLVAKAVAHESGANFMSIKGPELLNKYVGESERAVRQLFSRAR
AAHPCVLFFDELDALAPRRGTDNNQAAERVVNQLLTEMDGIDGRLGVFLVAATNRPDMIDPALLRPGRLD
KILYVPLPPPDGRAAILKALVRNTPLAPGVDIQSIGMSAR