Dusal.0788s00005.1.p (PRGDB228207)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228207	Dusal.0788s00005.1.p	RLP	putative	LRR, TM	Dunaliella salina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cre10.g454700.t1.2	Chlamydomonas reinhardtii	46.5	142	7e-27
Vocar.0015s0071.1.p	Volvox carteri	43.5	115	5e-20
99376	Micromonas	41.1	141	7e-19
ConsensusfromContig10976-snap_masked-ConsensusfromContig10976-abinit-gene-0.1-mRNA-1:cds:3761/1271-1310:0:+	Cyanophora paradoxa	34.9	132	6e-16
Cre01.g029150.t1.2	Chlamydomonas reinhardtii	36.1	133	1e-14
Vocar.0001s0903.1.p	Volvox carteri	37.3	118	4e-14
Pp3c10_9456V3.1.p	Physcomitrella patens	33.3	126	6e-14
Dusal.2492s00001.1.p	Dunaliella salina	47.5	101	8e-14
56816	Micromonas	34.8	141	8e-14
58565	Micromonas pusilla	35.2	122	3e-13

Showing 1 to 10 of 480 entries

Protein sequence

MEDEQPGQAEEEEEELLAPGSQQPQSLTFQHLRDGSGGEQDLKRAVTMNLHGKSLASIAALDECPNLRTL
DLSFNLITNIEGMSALSKLKELKLYDNRIASLAGLQGLSSLHTLDISSNKLASLEGLKGLRGLRVLKASG
NGLCSLNSLGRWASGLEALDISFNKLQDSRRERGTARGCPSNVLAMTEAVNFSHVKQH