Eucgr.D00662.1.p (PRGDB228576)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228576	Eucgr.D00662.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00661.1.p	Eucalyptus grandis	78.2	165	8e-94
Potri.011G046800.1	Populus trichocarpa	61.6	190	2e-78
MDP0000178596	Malus domestica	63.3	188	2e-78
Potri.004G038200.1	Populus trichocarpa	61.9	189	4e-78
Eucgr.D00663.1.p	Eucalyptus grandis	61.4	189	9e-78
Thecc1EG029929t1	Theobroma cacao	60.3	189	2e-76
VIT_19s0014g03230.t01	Vitis vinifera	65.3	167	3e-76
Prupe.4G041100.1.p	Prunus persica	63.2	190	3e-75
Glyma.07G193000.1.p	Glycine max	61.4	189	1e-74
Glyma.13G243000.1.p	Glycine max	65.1	166	2e-74

Showing 1 to 10 of 499 entries

Protein sequence

MQRLSAAVAKSVIRHDLILGHNSQIMQTLRPPCNVFINHRGVETKRNIASLLYDFLTLLDLRPFLDRKSM
KPGDKLFDEINGAIYGCKVGVAVFSPRYCESWFCLQELALLMETKKKVIPIFCDVKPSQLHVVDEVTHSA
GDLQRYRHALEEAKNTVGLSFCSSKGDWSKLLRDVSDAVVQNLPEAEEEKP