Eucgr.H03501.1.p (PRGDB228591)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228591	Eucgr.H03501.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.C01830.1.p	Eucalyptus grandis	44.8	163	4e-34
Potri.T003000.2	Populus trichocarpa	42.1	164	8e-34
Potri.T112700.2	Populus trichocarpa	41.1	163	1e-33
Eucgr.C00409.1.p	Eucalyptus grandis	52.9	138	3e-33
Potri.T112700.1	Populus trichocarpa	41.1	163	3e-33
Eucgr.C01422.1.p	Eucalyptus grandis	45.1	162	1e-32
Potri.T002100.1	Populus trichocarpa	39.3	163	2e-32
Potri.T011800.1	Populus trichocarpa	40.1	162	3e-32
Potri.T002500.1	Populus trichocarpa	38	187	6e-32
Eucgr.D02396.1.p	Eucalyptus grandis	48.7	150	6e-32

Showing 1 to 10 of 499 entries

Protein sequence

MIAYEQLHRKKACECEVFLSFSGKGALKNFADSLYKGMVDAGIGVFRNDYWLPRHEKIGLKAIKSSKISI
LILSRKYDSSRRCLDELVQVMKCTNDSSGHVVLPIFYRVKPADVRCEVDVCDPMVAEERKQVLKEISSLK
GWESDEIAAGYSNLFHQNLVKFLLLARYCL