Eucgr.E01994.1.p (PRGDB228594)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228594	Eucgr.E01994.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.E01990.1.p	Eucalyptus grandis	87	139	2e-76
Eucgr.E01983.1.p	Eucalyptus grandis	85.6	139	4e-75
Eucgr.E02004.1.p	Eucalyptus grandis	80.6	139	2e-70
Eucgr.D01601.1.p	Eucalyptus grandis	69.1	136	3e-61
Eucgr.D01599.2.p	Eucalyptus grandis	69.3	137	2e-59
Eucgr.D01599.1.p	Eucalyptus grandis	69.3	137	2e-59
Eucgr.E01998.1.p	Eucalyptus grandis	65.7	137	2e-55
Eucgr.C03974.1.p	Eucalyptus grandis	66.9	133	2e-54
Eucgr.L02872.1.p	Eucalyptus grandis	63.2	133	5e-51
Eucgr.F02533.1.p	Eucalyptus grandis	57.7	137	9e-47

Showing 1 to 10 of 499 entries

Protein sequence

MANCLYNGLISAGIRAFKDNEELRFGEEIEGGLLQAINDSRIYIPIFSKGYASSKWCLHELAHIVELPRG
NNEKVILPIFYDVDADDVKLKTKLYRKALRKHKSEYGKELAKKWKNALREVVRIRGRNLKDHGYYLLIH