Eucgr.E01799.1.p (PRGDB228610)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228610	Eucgr.E01799.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.E01863.1.p	Eucalyptus grandis	88.3	154	9e-91
Eucgr.E01866.1.p	Eucalyptus grandis	81.7	158	2e-90
Eucgr.E01861.1.p	Eucalyptus grandis	81.7	158	6e-88
Eucgr.E01810.1.p	Eucalyptus grandis	80.4	158	1e-82
Eucgr.E01836.1.p	Eucalyptus grandis	81.3	155	3e-82
Eucgr.E01803.1.p	Eucalyptus grandis	76.6	158	5e-79
Eucgr.E01804.1.p	Eucalyptus grandis	78.3	152	5e-77
Eucgr.E01852.1.p	Eucalyptus grandis	78.7	150	9e-74
Eucgr.H03529.1.p	Eucalyptus grandis	63.8	163	5e-73
Eucgr.H03845.1.p	Eucalyptus grandis	66.2	154	2e-72

Showing 1 to 10 of 499 entries

Protein sequence

MEKSSGYDYEVFLSFRGPDTRLDIADYLYVSMIDAGIRAYKDDEELRTGEEIGGQLLQAIQHSKISIPIF
SKGYADSPWCLRQLVKMVESKNTGGQKIMPIFYNVTPSEVKHQNEHYGNAIVSHLNKKRFNDETINNWKA
ALKEVGELKGWDLHSMLNSWQRI