Eucgr.F03897.1.p (PRGDB228612)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228612	Eucgr.F03897.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.K01937.1.p	Eucalyptus grandis	70.7	174	2e-77
Eucgr.F02533.1.p	Eucalyptus grandis	76.2	151	2e-73
Eucgr.F03913.1.p	Eucalyptus grandis	64.6	175	3e-69
Eucgr.F03914.1.p	Eucalyptus grandis	62.5	176	5e-67
Eucgr.C02718.1.p	Eucalyptus grandis	62.5	176	2e-66
Eucgr.C02567.1.p	Eucalyptus grandis	63.1	176	2e-64
Eucgr.F03896.1.p	Eucalyptus grandis	62.9	175	2e-63
Eucgr.D01601.1.p	Eucalyptus grandis	53.7	177	2e-60
Eucgr.C02558.1.p	Eucalyptus grandis	62.3	159	6e-59
Eucgr.C02470.1.p	Eucalyptus grandis	55.1	178	3e-58

Showing 1 to 10 of 499 entries

Protein sequence

MKRKWDSPGLSTVSASVDNGDLSSGAEFEVFLNFRGSDTRLNFTDCLYHALVKAGVRVFKDDEDIRQGEK
IGDELSHAIKSSKIYVPIFSRDYASSRWCLRKLTHMVDCSSKAKDKMILPIFYDVDPEDVKLRTQLYRDA
LGKHEEKFGHDVPRWKEALTEVAKISGSDLKNKG