Eucgr.H03815.1.p (PRGDB228631)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228631	Eucgr.H03815.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H03845.1.p	Eucalyptus grandis	86.4	110	7e-67
Eucgr.H03809.1.p	Eucalyptus grandis	89.1	110	8e-62
Eucgr.H03826.1.p	Eucalyptus grandis	79.8	109	1e-58
Eucgr.H03529.1.p	Eucalyptus grandis	75.5	110	1e-55
Eucgr.C01920.1.p	Eucalyptus grandis	77.6	107	2e-54
Eucgr.H03785.2.p	Eucalyptus grandis	76.4	110	3e-54
Eucgr.H03785.1.p	Eucalyptus grandis	76.4	110	3e-54
Eucgr.C01915.1.p	Eucalyptus grandis	75.7	107	4e-52
Eucgr.H03750.1.p	Eucalyptus grandis	76.4	110	5e-52
Eucgr.C01912.1.p	Eucalyptus grandis	77.9	104	5e-52

Showing 1 to 10 of 499 entries

Protein sequence

MATSLGYDYEVFLSFRGPDTRAGFTNFLYTNLDNAGIRTFRDDEELRIGEEFAPELLQAIKQSKISIPIF
SKGYASSVWCLKELVQMVACQKAGRQKIMPIFYDVAPSEV