Eucgr.I00029.2.p (PRGDB228664)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228664	Eucgr.I00029.2.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.I00029.1.p	Eucalyptus grandis	99.9	157	1e-113
Eucgr.I00026.1.p	Eucalyptus grandis	81.4	156	6e-86
Eucgr.E02219.1.p	Eucalyptus grandis	80.2	157	2e-83
Eucgr.E02914.1.p	Eucalyptus grandis	79.6	157	2e-82
Eucgr.E02587.2.p	Eucalyptus grandis	76.9	156	3e-82
Eucgr.E02587.1.p	Eucalyptus grandis	76.9	156	3e-82
Eucgr.E02290.1.p	Eucalyptus grandis	79.6	157	1e-81
Eucgr.E02189.1.p	Eucalyptus grandis	80.2	157	2e-81
Eucgr.E02532.1.p	Eucalyptus grandis	77.7	157	2e-81
Eucgr.E02599.1.p	Eucalyptus grandis	80.2	157	5e-81

Showing 1 to 10 of 499 entries

Protein sequence

MASSLKPKKIYDVFLSFRGAELRLNFISHLYQALIQNGIHTFWDSEELKKGDQISMLMEAIKESCIAVIV
FSQDYASSEWCLEEVAKIMECKEQRNLTVLPVFYKVDPKEVREGRESYRRALDKHESKFGKDSDKVKRWK
EALFNAGSLSGWHLNDE