Eucgr.H01806.1.p (PRGDB228669)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228669	Eucgr.H01806.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H02169.1.p	Eucalyptus grandis	91.7	156	1e-92
Eucgr.H01900.1.p	Eucalyptus grandis	84	156	6e-83
Eucgr.H01829.1.p	Eucalyptus grandis	80	150	7e-80
Eucgr.H01772.1.p	Eucalyptus grandis	77.6	156	3e-77
Eucgr.H02123.1.p	Eucalyptus grandis	80.7	150	5e-77
Eucgr.H01794.1.p	Eucalyptus grandis	76.7	150	6e-77
Eucgr.H01803.1.p	Eucalyptus grandis	79	148	1e-75
Eucgr.H02187.1.p	Eucalyptus grandis	78.7	150	3e-72
Eucgr.H02138.1.p	Eucalyptus grandis	71.8	156	7e-68
Eucgr.H01894.1.p	Eucalyptus grandis	75.5	139	2e-64

Showing 1 to 10 of 499 entries

Protein sequence

MSSSSSSSSSSSEEKWPFDVFINFRGEDVRSGFVADLHRCLSRGGINAYIDSEDLRRGDEISPALMKAIE
ESRIAVLVFSEDYASSRWCLDELVKVMECRRLKGQRVLPVFYKVEPGEIRGLRRRYGDTLARHEENLGQD
PERVDKWRQALIGAANLSGWHYIDAQSQ