Eucgr.E03094.1.p (PRGDB228677)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228677	Eucgr.E03094.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.E03285.1.p	Eucalyptus grandis	94.1	152	5e-97
Eucgr.E03291.1.p	Eucalyptus grandis	88.2	152	5e-91
Eucgr.E03067.1.p	Eucalyptus grandis	87.5	152	4e-87
Eucgr.E03077.1.p	Eucalyptus grandis	86.3	153	1e-84
Eucgr.E03092.1.p	Eucalyptus grandis	82.2	152	3e-83
Eucgr.E03284.1.p	Eucalyptus grandis	83.5	152	4e-83
Eucgr.E03080.1.p	Eucalyptus grandis	82.3	153	2e-82
Eucgr.E03085.1.p	Eucalyptus grandis	82.9	152	6e-82
Eucgr.E03277.1.p	Eucalyptus grandis	84.9	139	5e-80
Eucgr.E03084.1.p	Eucalyptus grandis	83	153	3e-79

Showing 1 to 10 of 499 entries

Protein sequence

MKRNYHVFLSFRGTDVRQGFLSHLYAALDQKGIFTFVDSEELRKGDEISMALMRAIEESHVAIIVFSEHY
TSSRWCLEELLKIMECKEQNGLKVFPVFYKVEPREVREGRDSYKRAMDNHESKLGKDSEKVKSWKKALSE
AGSLSGWELNDRSMGTWRHREDSNCQGPI