AHYPO_019246-RA (PRGDB22870)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB22870	AHYPO_019246-RA	RLP	putative	TM, LRR	Amaranthus hypochondriacus

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Ciclev10002748m	Citrus clementina	83.5	79	2e-38
AHYPO_015385-RA	Amaranthus hypochondriacus	87.7	73	7e-35
maker_scaffold5662_snap_gene_0_70_mRNA_1	Solanum commersonii	86.5	74	2e-34
DCAR_021841	Daucus carota	86.3	73	4e-34
Araha.24929s0001.1.p	Arabidopsis halleri	76	79	4e-34
AT4G33430.2	Arabidopsis thaliana	77.9	77	5e-34
LPERR08G04410.1	Leersia perrieri	82.2	73	9e-34
OMERI08G04540.1	Oryza meridionalis	82.2	73	2e-33
OBART08G04530.1	Oryza barthii	82.2	73	2e-33
Traes_7BS_9351C215F.1	Triticum aestivum	80	75	2e-33

Showing 1 to 10 of 499 entries

Protein sequence

MQLADKVTILSHDMGLLDLGNANLTGKLVTQLGQLPNLQYLELYSNHISGTVPYELGNLTNLVSLDLYLN
NLSGPIPDTLGKLLKLRFLYEYISFFYFLSITTFLISISFTIS