Eucgr.E03711.1.p (PRGDB228842)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228842	Eucgr.E03711.1.p	L	putative	LRR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.I00985.1.p	Eucalyptus grandis	75.5	163	1e-80
Eucgr.L02076.1.p	Eucalyptus grandis	74.8	163	5e-78
Eucgr.L02779.1.p	Eucalyptus grandis	65.2	161	2e-70
Eucgr.I00980.1.p	Eucalyptus grandis	83.3	126	3e-67
Eucgr.I00978.1.p	Eucalyptus grandis	69.6	135	4e-61
Prupe.7G139100.1.p	Prunus persica	54	163	1e-52
Prupe.7G139600.1.p	Prunus persica	52.8	161	2e-51
Prupe.7G139500.1.p	Prunus persica	53.4	161	3e-51
Prupe.7G139200.1.p	Prunus persica	52.2	161	2e-49
29676.m001639	Ricinus communis	52.2	161	6e-49

Showing 1 to 10 of 499 entries

Protein sequence

MPNLVELDIDYCNDLMTLPNGICEIKPLKKLSVTNCHNFSTLPEQIGQLTFLEVVRLNSYTKLLQLPDSI
ETLQKLEFLNLSDCLSLSTLPDQMGQLYNLKRINMRGCLRLSMLPRSIMRLRNLKKVICDKESEVLWEPL
KNSLNSLNIMAYEEEANLDWLWD