Eucgr.K02862.1.p (PRGDB229585)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB229585	Eucgr.K02862.1.p	KIN	putative	Kinase	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.K02865.1.p	Eucalyptus grandis	91.4	151	1e-83
30147.m013984	Ricinus communis	58.2	165	5e-60
Potri.012G078100.1	Populus trichocarpa	57.8	166	7e-60
Potri.015G073500.1	Populus trichocarpa	56.6	166	2e-59
Aqcoe3G112400.1.p	Aquilegia caerulea	56.9	167	7e-59
Manes.14G068200.1.p	Manihot esculenta	58.4	166	9e-59
Manes.17G123500.1.p	Manihot esculenta	58.5	164	5e-58
Thecc1EG012019t1	Theobroma cacao	57.4	162	7e-58
Lus10002360	Linum usitatissimum	56.5	161	5e-57
Lus10042135	Linum usitatissimum	55.9	161	4e-56

Showing 1 to 10 of 499 entries

Protein sequence

MHSVLHEDGIAHGNLKTTDILLDKDMGPCVSKYGLMVVESQDSSQISEIRSNPSAPHDAFKDDVYGLGLM
LLELLTGNMVQNNGYDLAKWVQSVVREEWTGEVFDSVLISEGADEERMVRLLQVALQCTNPPPAKRPSSS
QAVALMGKIKDEDERPLLSDS