Eucgr.K00494.1.p (PRGDB229793)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB229793	Eucgr.K00494.1.p	KIN	putative	TM, Kinase	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.K00535.1.p	Eucalyptus grandis	69.8	172	1e-78
Eucgr.K00490.1.p	Eucalyptus grandis	65.7	172	8e-76
Eucgr.K00520.1.p	Eucalyptus grandis	62.1	190	1e-75
Eucgr.K00523.1.p	Eucalyptus grandis	61.9	189	2e-74
Eucgr.K00488.1.p	Eucalyptus grandis	63.2	182	7e-73
Eucgr.K00565.1.p	Eucalyptus grandis	64.5	172	8e-73
Eucgr.K00492.1.p	Eucalyptus grandis	58.7	189	2e-72
Eucgr.L01263.1.p	Eucalyptus grandis	60.3	189	4e-72
Eucgr.K00526.1.p	Eucalyptus grandis	60.9	189	3e-71
Eucgr.K00515.1.p	Eucalyptus grandis	60.9	189	8e-71

Showing 1 to 10 of 499 entries

Protein sequence

MQILHFDIEPHNILIERDFIPKVSNFGHARLYLMDYNTMTLTVARGTLGYMAPELAYKNLGGISYKAYVY
GFGKLVMEMARERKNFHDQLSEGLDIPMEEASEENRRIIKKVMIVALWCIQLNPSKCPSMHKLLEMPEGK
VDDLQIPPKPLFYPTEIYDKMFSPRNNNTLD