EMT09302 (PRGDB232)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB232	EMT09302	RLP	putative	LRR, TM	Aegilops tauschii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Brast08G067600.1.p	Brachypodium stacei	38.2	144	2e-23
EMT24178	Aegilops tauschii	49.1	108	6e-23
Sobic.009G179000.1.p	Sorghum bicolor	46	100	1e-22
MLOC_73821.3	Hordeum vulgare	48.3	116	1e-22
Bradi2g20480.2.p	Brachypodium distachyon	52.5	80	2e-21
Eucgr.H03383.2.p	Eucalyptus grandis	50.6	87	2e-21
Eucgr.H03383.1.p	Eucalyptus grandis	50.6	87	3e-21
VIT_01s0146g00340.t01	Vitis vinifera	46.1	102	5e-21
MDP0000331536	Malus domestica	47.8	90	6e-21
GRMZM2G088861_P01	Zea mays	50	84	8e-21

Showing 1 to 10 of 499 entries

Protein sequence

MAPTAAESRLPLVAIVLATFASTLLLTPVAANQDVDALSALRRGLQDPNGELKNWDPNLVDACTWSHITC
DRNKNRVTRMDFSNNNLCGPIPTTGAFQRIPRSSFANNPRLGRKC