Eucgr.I02526.1.p (PRGDB232309)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB232309	Eucgr.I02526.1.p	N	putative	NBS	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.I02520.3.p	Eucalyptus grandis	69.4	206	2e-78
Eucgr.I02520.2.p	Eucalyptus grandis	69.4	206	5e-78
Eucgr.I02520.1.p	Eucalyptus grandis	69.4	206	7e-78
Eucgr.F01690.2.p	Eucalyptus grandis	53.4	206	1e-51
Eucgr.F01690.1.p	Eucalyptus grandis	53.4	206	2e-51
Eucgr.I02558.2.p	Eucalyptus grandis	43.7	206	4e-47
Eucgr.I02558.1.p	Eucalyptus grandis	43.7	206	1e-46
Eucgr.I02547.1.p	Eucalyptus grandis	43.7	206	1e-43
Potri.T004900.1	Populus trichocarpa	34.3	201	1e-28
MDP0000902193	Malus domestica	33.2	205	9e-27

Showing 1 to 10 of 499 entries

Protein sequence

MGQEEDVRVICLCGVEGIGKTVEATVIFERICLNFECFVFLNEIGEADQVGILGLQKKLLCNLTKVERWR
MNDDIQTDINKINSNDDIQTNINKINGNDNIQTNINKINSNMCRRRIFLVLDNVTSKEQIDYFGAGERDL
LCCGSRILITTRSQNLLKDLDVDDKYIVKGLDQNEALQLFCRHAWKREEPQEGYEELSRSLAHYAG