Eucgr.C02038.1.p (PRGDB232707)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB232707	Eucgr.C02038.1.p	CNT	putative	CC, NBS, TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.C02064.1.p	Eucalyptus grandis	93.6	219	5e-140
Eucgr.C02081.1.p	Eucalyptus grandis	98.7	152	8e-94
Eucgr.H03750.1.p	Eucalyptus grandis	36.5	222	2e-41
Eucgr.H03746.1.p	Eucalyptus grandis	37.8	222	3e-41
Eucgr.C02108.1.p	Eucalyptus grandis	38.2	238	8e-41
Eucgr.H03694.1.p	Eucalyptus grandis	36	222	8e-40
Eucgr.C01933.1.p	Eucalyptus grandis	38	221	2e-39
Lus10035674	Linum usitatissimum	37.4	219	2e-39
Eucgr.F03896.1.p	Eucalyptus grandis	36.1	219	2e-38
Lus10018658	Linum usitatissimum	36.8	220	6e-38

Showing 1 to 10 of 499 entries

Protein sequence

MPVYFLITAWDVEMKDGRGPYADKLAAHKEKGVDPDTVQNWVDALKEVTSVKGRQLTESTRQGEFAIMMV
SKVLKRLRKAKLNLSDKLVGIEDRLPELRRMLDTDSSDVRMIVISGIPGIGKTTLAKSLYNDICHLFDRH
SFLGDIGDTTDKKALLALQNQLVSDIVQRDSAKLKSVEEGISFLKLRLSTWKVLILLDDVHEKSQLEALV
GSLDWFGSG