Eucgr.F00908.1.p (PRGDB232736)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB232736	Eucgr.F00908.1.p	CN	putative	NBS, CC, TM	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.F00923.1.p	Eucalyptus grandis	83.9	186	2e-107
Eucgr.F00904.1.p	Eucalyptus grandis	88.4	181	2e-101
Eucgr.F00956.1.p	Eucalyptus grandis	87.3	181	1e-98
Eucgr.F00956.2.p	Eucalyptus grandis	87.3	181	1e-98
Eucgr.F00886.1.p	Eucalyptus grandis	83.4	181	6e-94
Eucgr.F00948.1.p	Eucalyptus grandis	76.8	181	9e-83
Eucgr.L01860.1.p	Eucalyptus grandis	85.1	141	2e-78
Eucgr.F00554.1.p	Eucalyptus grandis	72.4	181	1e-77
Eucgr.F00542.1.p	Eucalyptus grandis	84.6	143	4e-74
Eucgr.F00954.1.p	Eucalyptus grandis	70.7	181	2e-72

Showing 1 to 10 of 374 entries

Protein sequence

MNRCSSTMNLRSIYADDEEIRNLKRKVEELDDKEAVIKEQMEIESAASSSRRKPRILVERWLKETERAGN
NFQIIGQANAETLPPKERVETLMREVEELIGKLLPQTLLIEERDAKGVKLLERKLTGEVIHRNIELIWGR
LKKNRACKLGIYGMGGVGKTTIMMHIHNRLLEDATCDGVVLSPCPKISAFISCK