EMT00095 (PRGDB2328)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2328	EMT00095	KIN	putative	TM, Kinase	Aegilops tauschii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_1BL_2D09AC384.4	Triticum aestivum	81.5	108	1e-53
Traes_1BL_2D09AC384.3	Triticum aestivum	81.5	108	2e-53
Traes_1BL_B08DB5667.1	Triticum aestivum	73.2	108	2e-53
Traes_1BL_2D09AC384.2	Triticum aestivum	81.5	108	2e-53
Bradi3g07790.1.p	Brachypodium distachyon	66.4	107	4e-44
Bradi3g07790.5.p	Brachypodium distachyon	66.4	107	4e-44
Bradi3g07790.4.p	Brachypodium distachyon	66.4	107	4e-44
Bradi3g07790.2.p	Brachypodium distachyon	66.4	107	5e-44
Bradi3g07790.3.p	Brachypodium distachyon	66.4	107	5e-44
Bradi4g21980.2.p	Brachypodium distachyon	64.5	107	3e-41

Showing 1 to 10 of 499 entries

Protein sequence

MTRGYICALVWSHHYLRHNVKTFLGGYLPPEYVQQGLMTKEFDIFGLGVIIAKLMAGREGYSKIDDMKEK
MFIKHVHGNWRKKMRATLPPRQLEVYCEQVKTCIQIALECMKRERQERPAIQSIVSRLEQTEY