Eucgr.C02142.1.p (PRGDB232934)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB232934	Eucgr.C02142.1.p	TN	putative	NBS, TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.C02141.1.p	Eucalyptus grandis	64.7	170	4e-53
Eucgr.D02396.1.p	Eucalyptus grandis	43.4	175	2e-38
Eucgr.C01830.1.p	Eucalyptus grandis	42.4	177	2e-36
Eucgr.C00409.1.p	Eucalyptus grandis	42	174	2e-35
Eucgr.L03036.1.p	Eucalyptus grandis	39.8	176	1e-33
Eucgr.B01956.1.p	Eucalyptus grandis	42.9	177	1e-32
Eucgr.C02112.1.p	Eucalyptus grandis	38.8	178	2e-30
Eucgr.D02660.1.p	Eucalyptus grandis	39	182	3e-29
Eucgr.B01839.1.p	Eucalyptus grandis	38.5	174	2e-28
Eucgr.C02108.1.p	Eucalyptus grandis	35.9	195	4e-28

Showing 1 to 10 of 499 entries

Protein sequence

MGRRVGLRLLHTIARPKISIPIFSESCGASKRCLRQLVQMAADGKSAGQVVLPFFDGVERSHAPHQTGSF
QEAFRSQEMCFEQRDVEAGQQVLGDVSFLKGWEWERIVNGHRGEFVIIVVETDPSEFRQGFRINVPESLV
GNNDHIKKIMGLLDTTSNGTRRIGIYGMGGIGKITFTFGEFALQKIVNDSSR