Thhalv10024080m (PRGDB233138)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB233138	Thhalv10024080m	T	putative	TIR	Eutrema salsugineum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
917080	Arabidopsis lyrata	65.7	105	2e-44
Cagra.1562s0028.1.p	Conradina grandiflora	48.6	181	6e-44
AT5G44900.1	Arabidopsis thaliana	46.6	191	2e-43
Bostr.29514s0004.1.p	Babiana stricta	48.2	170	2e-41
Bostr.5342s0012.1.p	Babiana stricta	61.9	105	4e-40
Bostr.8819s0041.1.p	Babiana stricta	61.2	103	1e-39
AT1G51270.2	Arabidopsis thaliana	46.1	169	2e-39
Bostr.8819s0024.1.p	Babiana stricta	43.9	171	8e-39
AT1G51270.4	Arabidopsis thaliana	45.8	166	1e-38
AT1G51270.1	Arabidopsis thaliana	60	105	2e-38

Showing 1 to 10 of 499 entries

Protein sequence

MFINFRGDELRKGFVGFLVEALKREKVNVFVDDHELRGRELDHLFIRIENPKVAQTIFSERYTQSIWCLD
ELIKIKERMNQGNLQVIPIFYKVSSEDVKRLKGQLPGSEASEIYFVKVIVEEVKKVLTNISREENRGWPV
TKNREMQELVDINYVEATATEEEV